Tesamorelin

Batch documentation

Overview

Tesamorelin is a 44-residue synthetic GHRH analogue carrying an N-terminal trans-3-hexenoyl modification that blocks DPP-4 cleavage and extends plasma half-life well beyond native GHRH or unmodified Sermorelin. It stands as the only FDA-approved member of the GHRH-analogue class, marketed as Egrifta for HIV-associated lipodystrophy, with the approved label specifically covering reduction of excess visceral abdominal adipose tissue in lipodystrophic HIV-positive patients. For compounding pharmacy buyers, Vialdyne releases Tesamorelin acetate as a lyophilised powder against a ≥99.0% main-peak HPLC specification. At 44 residues, the sequence sits at the upper-middle of routine SPPS, and the release packet centres on peak-integration RP-HPLC plus ESI-MS confirming the N-terminal hexenoyl-modified mass, which is the diagnostic identity check. LC-MS/MS sequence verification can be included when required by an agreed pharmacy qualification protocol; the positional integrity of the hexenoyl group is load-bearing for biological activity, and intact-mass spec alone cannot localise the modification with complete confidence. Most catalogue volume moves as the standalone Tesamorelin vial for visceral-fat compounding and research, or as the pre-blended co-lyophilised Tesamorelin-plus-Ipamorelin presentation under the tesa-ipa-blend SKU for dual-pathway GH-axis preparations.

Applications & buyer fit

GH-axis peptides ship to two main buyer types: compounding pharmacies dispensing under physician supervision, and research labs studying somatotropic-axis pharmacology. Pharmacies typically want sterile-filled vials with the full release packet (sterility, endotoxin, CCI); labs typically want loose-format lyophilized powder with sequence verification. Blends (the CJC-1295 / Ipamorelin combination is the canonical example) are usually co-lyophilized rather than solution-mixed for potency stability.

Primary buyer fit: 503A / 503B compounding pharmacies and academic and contract research laboratories.

Specifications

CAS

218949-48-5

Sequence

(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Appearance

White to off-white lyophilized powder

Purity (HPLC)

≥ 99.0%

Strength

2 mg – 20 mg

Packaging

10 vials/box · base pack (multiples of 10)

Half-life

≈ 8 minutes

MOQ

On request

Lead time

10–18 days

Storage

Room temperature, protect from light

Certificate of Analysis

Representative COA previews for Tesamorelin; request the certificate matched to the offered or supplied lot from sales. These are previews — request the full high-resolution certificate for any lot.

VerifiedRequest full COA →

Tesamorelin

VD260428-TSM10200 · 98.94%

VerifiedRequest full COA →

Tesamorelin

VD260428-TSM20201 · 98.95%

VerifiedRequest full COA →

Tesamorelin

VD260428-TSM198 · 99.12%

VerifiedRequest full COA →

Tesamorelin

VD260428-TSM5199 · 99.45%

Regulatory note

Under the brand name Egrifta, the finished Tesamorelin drug carries FDA approval for HIV-associated lipodystrophy. On its own, however, the active does not appear on the 503A bulks list, and whether it can be compounded for off-label or other indications turns on the destination market's regulatory posture and shortage status at the time.

Selected literature

1. Falutz J, Allas S, Blot K, et al. Metabolic effects of a growth hormone-releasing factor in patients with HIV. N Engl J Med. 2007;357(23):2359-2370.
2. Falutz J, Potvin D, Mamputu JC, et al. Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension. J Acquir Immune Defic Syndr. 2010;53(3):311-322.
3. Stanley TL, Feldpausch MN, Oh J, et al. Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial. JAMA. 2014;312(4):380-389.
4. Stanley TL, Fourman LT, Feldpausch MN, et al. Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. Lancet HIV. 2019;6(12):e821-e830.
5. Baker LD, Barsness SM, Borson S, et al. Effects of growth hormone-releasing hormone on cognitive function in adults with mild cognitive impairment and healthy older adults: results of a controlled trial. Arch Neurol. 2012;69(11):1420-1429.
6. Badran AS, Helal A, Shata KS, Ayesh H. Body composition, hepatic fat, metabolic, and safety outcomes of Tesamorelin, a GHRH analogue, in HIV-associated lipodystrophy: a meta-analysis of randomized controlled trials. Obesity Research & Clinical Practice. 2026;20(1):2-12.

Frequently asked questions