Ask sales for the Certificate of Analysis matched to the offered or supplied lot; it records the tests actually completed, applicable specifications, and reported results.

Matching batch COA available.

FDA PCAC reviews 7 peptides for the 503A bulks list (BPC-157, KPV, TB-500, MOTs-C, Emideltide, Semax, Epitalon). Read our compounder's decision tree. Read our briefing →

FDA PCAC: 7 peptides under review. Read →

TB-500

Name: TB-500
Brand: Vialdyne
SKU: tb-500

Thymosin β4 fragment

≥ 99.0%CAS 77591-33-4Repair Peptides

Vialdyne primary owner

TB-500 release-packet review for pharmacy QA and regulated procurement

This Vialdyne page is the primary SEO owner for buyers evaluating TB-500 through a pharmacy QA, clinic procurement, or regulated-sourcing workflow. It should answer whether the buyer can request a batch COA, release-test scope, destination-market review, and add-on documentation before moving into pricing or repeat inventory planning.

Use this page when the buyer needs release documentation, lot-specific QA evidence, and destination-market fit before supplier approval.
Ask for a release packet when the next decision is pharmacy qualification, recurring inventory planning, or internal QA-file review.
Broad catalog economics and analytical/reference-standard method packets sit outside this page's compounding-procurement focus.

Overview

TB-500 is a 43-residue synthetic peptide derived from Thymosin beta-4, the actin-sequestering protein expressed across essentially every mammalian cell type. Biological activity centres on actin binding via the central LKKTETQ motif, with downstream effects on cell migration, angiogenesis, and tissue regeneration, the mechanistic substrate for the published TB-500 literature on wound healing, cardiac remodelling, and tendon-ligament repair models. The 43-residue length keeps the molecule serum-stable but gastric-labile, so all documented use is via injectable routes. For 503A patient-specific compounders, TB-500 is scheduled for FDA PCAC review at the July 2026 meeting against the 503A bulks-list criteria, with the proposed indication of wound healing. Vialdyne releases TB-500 acetate as a lyophilised powder against a ≥99.0% main-peak HPLC specification. At 43 residues the sequence sits in the upper-middle of routine SPPS, synthesis is reliable but the purification regime has to work harder than for shorter peptides like BPC-157, and the standard release packet leans on peak-integration HPLC plus ESI-MS to clear closely-eluting deletion sequences. LC-MS/MS sequence verification is an available add-on under an agreed pharmacy qualification protocol: for a 43-mer, the residue-mass ambiguity of mass-spec alone is meaningfully larger than for a 15-mer, and only tandem MS demonstrates that the synthesised sequence matches the labelled one. TB-500 is dispensed either as the standalone vial or co-lyophilised with BPC-157 as the Wolverine Blend (5+5 mg per 10 mg vial standard; non-standard ratios available under change-control). Two companion pieces flesh out the procurement picture: our mechanism-and-analytics [BPC-157-vs-TB-500 comparison](/insights/bpc-157-vs-tb-500-side-by-side), and the regulatory-framing [overview of 503A vs 503B compounding pathways](/insights/503a-vs-503b-compounding-pharmacy-peptides).

Applications & buyer fit

Repair peptides, BPC-157, TB-500, and related sequences, typically ship to research labs studying tissue-repair, gastrointestinal, or tendon-ligament models, and to compounding pharmacies that have validated the active material into their workflow. Buyers should request the batch COA for the lot offered or shipped and define any sequence-level evidence required by their written qualification procedure before quotation; Vialdyne does not require buyers to repeat the lot-release tests recorded on the COA.

How TB-500 is sourced

Sourced for

Research into tissue-repair, gastrointestinal, and tendon-ligament models
Compounding-pharmacy workflows where the active has been validated in

Buyer fit

503A / 503B compounding pharmacies
academic and contract research laboratories

Documentation that ships

Certificate of Analysis (COA)
HPLC Chromatogram
Mass-spec identity (ESI-MS)
Sequence verification (LC-MS/MS)
Water content (Karl Fischer)
Counter-ion analysis
SDS / MSDS
Stability data on request

Procurement note: Start with the applicable batch COA. Add tandem-MS sequence evidence only when the buyer's written procurement procedure requires it and the scope is agreed before quotation.

Primary buyer fit: 503A / 503B compounding pharmacies and academic and contract research laboratories.

Specifications

CAS: 77591-33-4
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Appearance: White to off-white lyophilized powder
Purity (HPLC): ≥ 99.0%
Strength: 2 mg – 10 mg
Packaging: 10 vials/box · base pack (multiples of 10)
Half-life: ≈ 1.5-3 hours
MOQ: On request
Lead time: 7–14 days
Storage: 2–8°C, protect from light

Certificate of Analysis

Representative COA previews for TB-500; request the certificate matched to the offered or supplied lot from sales. These are previews — request the full high-resolution certificate for any lot.

VerifiedRequest full COA →

TB-500

VD260428-TB10195 · 98.88%

VerifiedRequest full COA →

TB-500

VD260428-TB193 · 99.30%

VerifiedRequest full COA →

TB-500

VD260428-TB5194 · 99.53%

Browse all published COAs

Independent analytical testing

Product- and strength-matched first-page previews are shown separately from Vialdyne's lot-specific Batch COAs. Reference the report number when requesting the complete, high-resolution file from sales.

Third-party testView report record →

TB-500 / Thymosin beta-4

10 mg · HPLC / MS

TB10-20260810S7175

Third-party testing in Tianjin

Independent HPLC and mass-spectrometry reports from Qorix , the professional, authoritative third-party analytical laboratory at tjqxgd.com, affiliated with the Tianjin International Joint Academy of Biomedicine.

Regulatory note

The FDA's PCAC is presently reviewing TB-500 (July 2026) for the 503A bulks list, the proposed indication being wound healing.

Selected literature

Esposito S, Deventer K, Goeman J, Van der Eycken J, Van Eenoo P. Synthesis and characterization of the N-terminal acetylated 17-23 fragment of thymosin beta 4 identified in TB-500, a product suspected to possess doping potential. Drug Test Anal. 2012;4(9):733-738.
Philp D, Huff T, Gho YS, Hannappel E, Kleinman HK. The actin binding site on thymosin beta4 promotes angiogenesis. FASEB J. 2003;17(14):2103-2105.
Bock-Marquette I, Saxena A, White MD, DiMaio JM, Srivastava D. Thymosin beta4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair. Nature. 2004;432(7016):466-472.
Xing Y, Ye Y, Zuo H, Li Y. Progress on the function and application of thymosin β4. Front Endocrinol (Lausanne). 2021;12:767785.
Sosne G, Kleinman HK, Springs C, Gross RH, Sung J, Kang S. 0.1% RGN-259 (Thymosin β4) ophthalmic solution promotes healing and improves comfort in neurotrophic keratopathy patients in a randomized, placebo-controlled, double-masked phase III clinical trial. Int J Mol Sci. 2022;24(1):554.
Wei C, Kumar S, Kim IK, Gupta S. Thymosin beta 4 protects cardiomyocytes from oxidative stress by targeting anti-oxidative enzymes and anti-apoptotic genes. PLoS One. 2012;7(8):e42586.

Frequently asked questions

What is TB-500 and how does it differ from native Thymosin beta-4?▾

TB-500 is a 43-residue synthetic peptide corresponding to the mature, N-terminally acetylated form of native Thymosin beta-4 (43 residues in its mature acetylated chain; the 44-residue figure refers to the precursor including the initiator methionine). The synthetic sequence preserves the LKKTETQ actin-binding motif that drives biological activity. Two practical advantages distinguish synthetic TB-500 from recombinant full-length Thymosin beta-4: it is materially cheaper to produce at compounding-pharmacy scale, and it sidesteps the lot-to-lot variability inherent in cell-line-expressed biological products. For the actin-binding and tissue-regeneration endpoints that dominate the published literature, per-mass activity is functionally equivalent between the two.

Why is sequence verification more important for TB-500 than for shorter repair peptides?▾

Length is the issue. At 43 residues, TB-500 sits at the upper-middle of routine SPPS, and longer peptides accumulate single-residue deletion sequences during synthesis that elute right up against the target peak on RP-HPLC. They pass the standard purity-percentage gate but are not the molecule on the label. Mass spec resolves identity to within 0.5 Da of theoretical, but cannot distinguish a Lys-deletion at position 12 from a Lys-deletion at position 30, both have the same residue mass. Only LC-MS/MS with a full b- and y-ion ladder demonstrates positional integrity. This is the standard qualification test we recommend for any 40-plus residue peptide entering a new pharmacy's quality system.

What's the practical difference between using TB-500 alone vs. the Wolverine Blend with BPC-157?▾

Mechanistically the two peptides are not interchangeable. TB-500 works through actin sequestration, modulating cell migration and tissue remodelling. BPC-157 works through nitric-oxide-pathway modulation and growth-factor-receptor cross-talk. The complementary mechanisms are why the two get combined so frequently in repair-focused compounding protocols. The Wolverine Blend SKU presents both peptides in a single co-lyophilised vial at a 5+5 mg standard ratio (other ratios under change-control), with a single COA certifying both component purities and the in-vial ratio, which reduces the document-handling burden on the receiving pharmacy's QA file.

Related peptides

Buyers who view TB-500 also ask about:

15-mer

BPC-157

≥99.0%

Body Protection Compound 15-mer

CAS: 137525-51-0
Vial: 2 mg–20 mg

MOQ on requestGet quote →

Wolverine Blend (BPC-157 + TB-500)

≥99.0%

Co-lyophilised BPC-157 + TB-500 repair blend

CAS: —
Vial: 20 mg

MOQ on requestGet quote →

See full catalog

TB-500

Thymosin β4 fragment

≥ 99.0%CAS 77591-33-4Repair Peptides

Vialdyne primary owner

TB-500 release-packet review for pharmacy QA and regulated procurement

Use this page when the buyer needs release documentation, lot-specific QA evidence, and destination-market fit before supplier approval.
Ask for a release packet when the next decision is pharmacy qualification, recurring inventory planning, or internal QA-file review.
Broad catalog economics and analytical/reference-standard method packets sit outside this page's compounding-procurement focus.

Overview

Applications & buyer fit

How TB-500 is sourced

Sourced for

Research into tissue-repair, gastrointestinal, and tendon-ligament models
Compounding-pharmacy workflows where the active has been validated in

Buyer fit

503A / 503B compounding pharmacies
academic and contract research laboratories

Documentation that ships

Certificate of Analysis (COA)
HPLC Chromatogram
Mass-spec identity (ESI-MS)
Sequence verification (LC-MS/MS)
Water content (Karl Fischer)
Counter-ion analysis
SDS / MSDS
Stability data on request

Procurement note: Start with the applicable batch COA. Add tandem-MS sequence evidence only when the buyer's written procurement procedure requires it and the scope is agreed before quotation.

Primary buyer fit: 503A / 503B compounding pharmacies and academic and contract research laboratories.

Specifications

CAS: 77591-33-4
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Appearance: White to off-white lyophilized powder
Purity (HPLC): ≥ 99.0%
Strength: 2 mg – 10 mg
Packaging: 10 vials/box · base pack (multiples of 10)
Half-life: ≈ 1.5-3 hours
MOQ: On request
Lead time: 7–14 days
Storage: 2–8°C, protect from light

Certificate of Analysis

Representative COA previews for TB-500; request the certificate matched to the offered or supplied lot from sales. These are previews — request the full high-resolution certificate for any lot.

VerifiedRequest full COA →

TB-500

VD260428-TB10195 · 98.88%

VerifiedRequest full COA →

TB-500

VD260428-TB193 · 99.30%

VerifiedRequest full COA →

TB-500

VD260428-TB5194 · 99.53%

Browse all published COAs

Independent analytical testing

Third-party testView report record →

TB-500 / Thymosin beta-4

10 mg · HPLC / MS

TB10-20260810S7175

Third-party testing in Tianjin

Regulatory note

The FDA's PCAC is presently reviewing TB-500 (July 2026) for the 503A bulks list, the proposed indication being wound healing.

Selected literature

Esposito S, Deventer K, Goeman J, Van der Eycken J, Van Eenoo P. Synthesis and characterization of the N-terminal acetylated 17-23 fragment of thymosin beta 4 identified in TB-500, a product suspected to possess doping potential. Drug Test Anal. 2012;4(9):733-738.
Philp D, Huff T, Gho YS, Hannappel E, Kleinman HK. The actin binding site on thymosin beta4 promotes angiogenesis. FASEB J. 2003;17(14):2103-2105.
Bock-Marquette I, Saxena A, White MD, DiMaio JM, Srivastava D. Thymosin beta4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair. Nature. 2004;432(7016):466-472.
Xing Y, Ye Y, Zuo H, Li Y. Progress on the function and application of thymosin β4. Front Endocrinol (Lausanne). 2021;12:767785.
Sosne G, Kleinman HK, Springs C, Gross RH, Sung J, Kang S. 0.1% RGN-259 (Thymosin β4) ophthalmic solution promotes healing and improves comfort in neurotrophic keratopathy patients in a randomized, placebo-controlled, double-masked phase III clinical trial. Int J Mol Sci. 2022;24(1):554.
Wei C, Kumar S, Kim IK, Gupta S. Thymosin beta 4 protects cardiomyocytes from oxidative stress by targeting anti-oxidative enzymes and anti-apoptotic genes. PLoS One. 2012;7(8):e42586.

Frequently asked questions

What is TB-500 and how does it differ from native Thymosin beta-4?▾

Why is sequence verification more important for TB-500 than for shorter repair peptides?▾

What's the practical difference between using TB-500 alone vs. the Wolverine Blend with BPC-157?▾

Related peptides

Buyers who view TB-500 also ask about:

15-mer

BPC-157

≥99.0%

Body Protection Compound 15-mer

CAS: 137525-51-0
Vial: 2 mg–20 mg

MOQ on requestGet quote →

Wolverine Blend (BPC-157 + TB-500)

≥99.0%

Co-lyophilised BPC-157 + TB-500 repair blend

CAS: —
Vial: 20 mg

MOQ on requestGet quote →

See full catalog