TB-500 (Thymosin Beta-4, full-length)

Batch documentation

Overview

TB-500 here is synthetic full-length Thymosin beta-4, the 43-residue, N-terminally acetylated actin-sequestering protein expressed across essentially every mammalian cell type. It is not the seven-residue Ac-LKKTETQ fragment (residues 17–23), which is listed separately as TB-500 (fragment 17-23). Biological activity centres on actin binding via the central LKKTETQ motif, with downstream effects on cell migration, angiogenesis, and tissue regeneration, the mechanistic substrate for the published TB-500 literature on wound healing, cardiac remodelling, and tendon-ligament repair models. The 43-residue length keeps the molecule serum-stable but gastric-labile, so all documented use is via injectable routes. For 503A patient-specific compounders, TB-500 is scheduled for FDA PCAC review at the July 2026 meeting against the 503A bulks-list criteria, with the proposed indication of wound healing. Vialdyne releases TB-500 acetate as a lyophilised powder against a ≥99.0% main-peak HPLC specification. At 43 residues the sequence sits in the upper-middle of routine SPPS, synthesis is reliable but the purification regime has to work harder than for shorter peptides like BPC-157, and the standard release packet leans on peak-integration HPLC plus ESI-MS to clear closely-eluting deletion sequences. LC-MS/MS sequence verification is an available add-on under an agreed pharmacy qualification protocol: for a 43-mer, the residue-mass ambiguity of mass-spec alone is meaningfully larger than for a 15-mer, and only tandem MS demonstrates that the synthesised sequence matches the labelled one. TB-500 is dispensed either as the standalone vial or co-lyophilised with BPC-157 as the Wolverine Blend (1:1 standard fills of 5+5, 10+10, and 15+15 mg; non-standard ratios available under change-control). Two companion pieces flesh out the procurement picture: our mechanism-and-analytics BPC-157-vs-TB-500 comparison, and the regulatory-framing overview of 503A vs 503B compounding pathways.

Applications & buyer fit

Repair peptides, BPC-157, TB-500, and related sequences, typically ship to research labs studying tissue-repair, gastrointestinal, or tendon-ligament models, and to compounding pharmacies that have validated the active material into their workflow. Buyers should request the batch COA for the lot offered or shipped and define any sequence-level evidence required by their written qualification procedure before quotation; Vialdyne does not require buyers to repeat the lot-release tests recorded on the COA.

Primary buyer fit: 503A / 503B compounding pharmacies and academic and contract research laboratories.

Specifications

CAS

77591-33-4

Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Appearance

White to off-white lyophilized powder

Purity (HPLC)

≥ 99.0%

Strength

2 mg – 20 mg

Packaging

10 vials/box · base pack (multiples of 10)

Half-life

≈ 1.5-3 hours

MOQ

On request

Lead time

7–14 days

Storage

2–8°C, protect from light

Certificate of Analysis

Representative COA previews for TB-500 (Thymosin Beta-4, full-length); request the certificate matched to the offered or supplied lot from sales. These are previews — request the full high-resolution certificate for any lot.

VerifiedRequest full COA →

TB-500 (Thymosin Beta-4, full-length)

VD260428-TB10195 · 98.88%

VerifiedRequest full COA →

TB-500 (Thymosin Beta-4, full-length)

VD260428-TB193 · 99.30%

VerifiedRequest full COA →

TB-500 (Thymosin Beta-4, full-length)

VD260428-TB5194 · 99.53%

Independent analytical testing

Product- and strength-matched first-page previews are shown separately from Vialdyne's lot-specific Batch COAs. Reference the report number when requesting the complete, high-resolution file from sales.

Third-party testView report record →

TB-500 / Thymosin beta-4

10 mg · HPLC / MS

TB10-20260810S7175

Regulatory note

The FDA's PCAC is presently reviewing TB-500 (July 2026) for the 503A bulks list, the proposed indication being wound healing.

Selected literature

1. Esposito S, Deventer K, Goeman J, Van der Eycken J, Van Eenoo P. Synthesis and characterization of the N-terminal acetylated 17-23 fragment of thymosin beta 4 identified in TB-500, a product suspected to possess doping potential. Drug Test Anal. 2012;4(9):733-738.
2. Philp D, Huff T, Gho YS, Hannappel E, Kleinman HK. The actin binding site on thymosin beta4 promotes angiogenesis. FASEB J. 2003;17(14):2103-2105.
3. Bock-Marquette I, Saxena A, White MD, DiMaio JM, Srivastava D. Thymosin beta4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair. Nature. 2004;432(7016):466-472.
4. Xing Y, Ye Y, Zuo H, Li Y. Progress on the function and application of thymosin β4. Front Endocrinol (Lausanne). 2021;12:767785.
5. Sosne G, Kleinman HK, Springs C, Gross RH, Sung J, Kang S. 0.1% RGN-259 (Thymosin β4) ophthalmic solution promotes healing and improves comfort in neurotrophic keratopathy patients in a randomized, placebo-controlled, double-masked phase III clinical trial. Int J Mol Sci. 2022;24(1):554.
6. Wei C, Kumar S, Kim IK, Gupta S. Thymosin beta 4 protects cardiomyocytes from oxidative stress by targeting anti-oxidative enzymes and anti-apoptotic genes. PLoS One. 2012;7(8):e42586.

Frequently asked questions