LL-37

Overview

LL-37 is the sole human cathelicidin-derived antimicrobial peptide, a 37-residue amphipathic helix released from the hCAP18 precursor. Beyond broad-spectrum antimicrobial activity it is studied as an immunomodulatory and wound-healing peptide, with research lines spanning innate immunity, chemotaxis, angiogenesis, and host-defence biology. Vialdyne releases lyophilised LL-37 to a ≥99.0% HPLC main-peak specification. Because LL-37 is a long, cationic, aggregation-prone sequence, the batch COA pairs RP-HPLC purity with ESI-MS identity; peptide-content assay, water (Karl Fischer), counter-ion, residual solvents and endotoxin are available on request and listed on the COA when tested, and full LC-MS/MS sequence confirmation is the recommended add-on when qualifying the peptide as a new reference standard.

Applications & buyer fit

Buyers in this category are research labs studying immune-modulation, cytokine signaling, and antimicrobial activity. The defining QC requirement is bacterial-endotoxin control: many of the downstream assays (NF-κB reporters, macrophage activation panels, neutrophil-priming readouts) are themselves activated by endotoxin contamination, so a clean LAL on the specific batch is a precondition rather than a nice-to-have. LL-37 and related cationic antimicrobial peptides additionally benefit from low-bind plasticware during dilution.

Primary buyer fit: academic and contract research laboratories.

Specifications

CAS

154947-66-7

Molecular Formula

C205H340N60O53

Molecular Weight

4493.33 g/mol

Sequence

[LL-37, 37 aa]

Appearance

White to off-white lyophilized powder

Purity (HPLC)

≥ 99.0%

Strength

5 mg

Packaging

10 vials/kit · base pack (multiples of 10)

Half-life

≈ 90-120 minutes

MOQ

On request

Lead time

10–18 days

Storage

-20°C, protect from light

Nasal spray listing · US inventory

LL-37 is also listed in this catalog as a nasal spray solution.

Listed contents

5 mg / 10 mg

Fill

10 mL or 20 mL bottle

MOQ

10 bottles per content and fill

Dispatch

Within the United States, from US inventory

Request nasal spray details

Batch COAs and test reports

Each picture is a low-resolution preview of a report's first page, with batch and report numbers covered. For the full, clear report, ask our sales team, naming the product and strength.

Batch COA

LL-37 5 mg

HPLC purity · MS identity

Batch COA

Full, clear copy from sales

Independent test fails? Full refund. How it works

Regulatory note

Research-use-only reference material; not for human or veterinary use. Cationic antimicrobial peptide intended for in-vitro and pre-clinical research.

Selected literature

1. Agerberth B, Gunne H, Odeberg J, Kogner P, Boman HG, Gudmundsson GH. FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis. Proc Natl Acad Sci U S A. 1995;92(1):195-199.
2. Dürr UHN, Sudheendra US, Ramamoorthy A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006;1758(9):1408-1425.
3. Bals R, Wang X, Zasloff M, Wilson JM. The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity at the airway surface. Proc Natl Acad Sci U S A. 1998;95(16):9541-9546.
4. Koczulla R, von Degenfeld G, Kupatt C, et al. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. J Clin Invest. 2003;111(11):1665-1672.
5. Yang B, Good D, Mosaiab T, et al. Significance of LL-37 on immunomodulation and disease outcome. Biomed Res Int. 2020;2020:8349712.
6. Ohuchi K, Ikawa T, Amagai R, et al. LL-37 might promote local invasion of melanoma by activating melanoma cells and tumor-associated macrophages. Cancers (Basel). 2023;15(6):1678.

Frequently asked questions