BPC-157 vs TB-500: side-by-side on chemistry, mechanism, and stack rationale
The two most-requested repair peptides compared on sequence, mechanism, analytics, and why the Wolverine Blend combines them rather than dosing them sequentially.
Published May 15, 2026 · 9 min read · By Vialdyne Regulatory Team
BPC-157 and TB-500 are the two most-requested repair peptides at Vialdyne's quote desk, and they are also the two most commonly confused. Both are studied for tissue-repair applications, both are under FDA PCAC review for the July 2026 503A bulks list, and both are routinely combined in compounding and research workflows. But the molecules are chemically distinct, mechanistically distinct, and operationally distinct, buyers should choose between them based on what their downstream application actually needs.
At a glance
| Property | BPC-157 | TB-500 |
|---|---|---|
| Sequence length | 15 amino acids | 43 amino acids |
| Sequence | GEPPPGKPADDAGLV | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| CAS | 137525-51-0 | 885340-08-9 |
| MW | 1419.55 g/mol | ≈4963 g/mol |
| Native parent | Body Protection Compound (gastric juice) | Thymosin β4 fragment |
| Mechanism | NO pathway + growth-factor cross-talk | Actin-binding, cellular migration |
| Oral bioavailability | Some, proline-rich, protease-resistant | Negligible, injection-only |
| Synthesis | Reliable | More demanding |
| Sequence-verification urgency | Moderate | High |
| 503A bulks-list status | Under PCAC review (July 2026) | Under PCAC review (July 2026) |
Mechanism, complementary, not redundant
This is the key concept and the reason the two peptides are combined rather than alternated.
BPC-157 signals through nitric-oxide-pathway modulation and growth-factor-receptor cross-talk. Published mechanistic studies show effects on VEGF, FGF-2, and EGFR-pathway signaling, with downstream consequences for angiogenesis, gastric-mucosa healing, and tendon-fibroblast activation.
TB-500 binds actin monomers and prevents their incorporation into actin filaments, the central LKKTETQ motif is the actin-binding region. The downstream consequence is enhanced cellular migration (because actin-monomer pool availability affects motility), angiogenesis through endothelial-cell migration, and tissue-remodeling through fibroblast migration.
These are entirely different molecular mechanisms. The "repair-stack" rationale isn't "one of them works, dose both for redundancy", it's "they act on parallel pathways, dose both for additive effects across pathways." Published research on the BPC + TB combination supports the additivity hypothesis.
Analytical considerations
For a 15-residue BPC-157, mass-spec identity confirmation is typically sufficient, the molecule's mass and HPLC retention time are diagnostic. Sequence verification by LC-MS/MS is a useful first-time qualification check but not generally needed per batch.
For a 43-residue TB-500, mass alone leaves more identity ambiguity because single-residue deletion products elute close to the target peak on RP-HPLC and pass the mass check within tolerance. LC-MS/MS sequence verification is strongly recommended at first-time supplier qualification and is the analytical practice that meaningfully distinguishes one TB-500 supplier from another.
Operational guidance
For research and compounding workflows using either peptide alone:
- BPC-157 alone: standard 2-10 mg lyophilized vials. Reconstitute in BWFI for multi-use, SWFI for single-use. Aliquot into single-use volumes; freeze-thaw discipline matters.
- TB-500 alone: standard 2-10 mg lyophilized vials. Same reconstitution guidance. TB-500 is somewhat more adsorptive than BPC-157, consider low-bind plasticware for working dilutions below 100 µg/mL.
For workflows using both peptides (the canonical case):
- Use the Wolverine Blend SKU rather than self-mixing from separate vials. The co-lyophilized blend certifies the actual ratio in the released vial and simplifies the analytical chain. Standard ratio is 1:1 by mass (5+5 mg or 10+10 mg), with custom ratios available via OEM service.
Regulatory trajectory
Both peptides are on the July 2026 PCAC agenda for 503A bulks-list consideration. BPC-157 is proposed for ulcerative colitis indication; TB-500 is proposed for wound healing. The PCAC recommendations are advisory; FDA's decision typically follows several months later. For procurement teams: regardless of how PCAC votes, the documentation-depth expectations buyers will hold suppliers to are already structurally raised compared with the pre-PCAC-review era.